Delicious Shrimp and Crab Biscuits | Easywhiskrecipes
30-MINUTE MEALS! Get the email series now
Easywhiskrecipes

Delicious Shrimp and Crab Biscuits

5 from 1 vote
1 Comments
Sophie Lane
By: Sophie LaneUpdated: Jun 13, 2026
This post may contain affiliate links. Please read our disclosure policy.

Flaky biscuit pockets stuffed with tender shrimp, sweet lump crab, sharp cheddar, and a zesty mayo-Dijon mix — perfect for brunch, parties, or a cozy night in.

Delicious Shrimp and Crab Biscuits

This recipe for Shrimp and Crab Biscuits began as a weeknight experiment and quickly became a signature at family gatherings. I discovered this combination on a rainy evening when I had leftover cooked shrimp and a can of lump crab in the pantry; the idea of tucking a creamy, savory seafood filling into store-bought biscuit dough felt both indulgent and achievable. The first time I served them, my partner closed their eyes mid-bite and said, "These belong at every holiday table." That memory sealed it for me: simple technique, big flavor, and unmistakable comfort.

These pockets deliver a rich interplay of textures — flaky, golden biscuit exterior giving way to a lush, cheesy seafood center. The sharp cheddar provides savory depth while mayonnaise and Dijon add silkiness and a subtle tang; lemon juice brightens the whole bite. The Old Bay and garlic powder lend classic coastal seasoning without overpowering the delicate crab, and the chopped shrimp keeps each mouthful textural and satisfying. They’re easy enough for a casual weekend brunch yet elegant enough for entertaining, and they reheat beautifully if you make a batch ahead.

Why You'll Love This Recipe

  • Ready quickly using refrigerated biscuit dough — no yeast or rolling required, so you can have a fresh-baked appetizer in about 30 minutes from start to finish.
  • Uses pantry and fridge staples: cooked shrimp, canned or fresh lump crab, cheddar, and mayo are easy to source and assemble.
  • Crowd-pleasing flavor profile that suits brunch, game-day snacks, or cocktail parties — they travel well and can be dipped in aioli or warmed lemon butter.
  • Make-ahead friendly: filling can be mixed and chilled up to 24 hours, and assembled pockets can be refrigerated briefly before baking to keep seams sealed.
  • Flexible and forgiving: adjust heat, cheese, or seasonings to taste; also easy to portion smaller or larger depending on your guest list.

When I first served these to a jittery house full of guests during a summer storm, they vanished in minutes. Family members who normally avoid shellfish asked for seconds, and a picky teenager declared them the best thing I’d ever made. That mix of surprise and satisfaction is what keeps me returning to this recipe.

Ingredients

  • Cooked shrimp (1 cup): Use peeled, deveined shrimp about 1/2–3/4" in size. If using frozen, thaw completely and pat dry to avoid a watery filling — smaller shrimp are fine if chopped to maintain texture.
  • Lump crab meat (1 cup): Choose refrigerated lump crab or well-drained canned crab. Handle gently and keep larger flakes intact to showcase the sweet crab texture.
  • Sharp cheddar (1 cup, shredded): Aged cheddar adds savory bite and melts smoothly; grate from a block for best texture (avoid pre-shredded mixes with anti-caking agents for creamier melt).
  • Mayonnaise (1/2 cup): Provides creaminess and structure. Use full-fat mayo for richness; an egg-free mayo will alter flavor slightly but still works.
  • Dijon mustard (1 tbsp) & lemon juice (1 tbsp): These balance the richness — Dijon gives a subtle heat and emulsification while lemon lifts the seafood flavors.
  • Old Bay (1 tsp) & garlic powder (1 tsp): Classic seasoning that complements seafood. Adjust Old Bay to taste for more pronounced coastal character.
  • Salt & black pepper: Season gently — crab can be salty, so taste before adding too much salt.
  • Refrigerated biscuit dough (1 package, 8-count): The shortcut that makes this recipe effortless; use buttermilk or flaky biscuit variety for the best rise and texture.
  • Fresh parsley (for garnish): Brightens presentation and adds herbaceous notes; chopped flat-leaf parsley is ideal.

Instructions

Prepare the filling: In a medium bowl, combine 1 cup chopped cooked shrimp, 1 cup gently drained lump crab meat, 1 cup shredded sharp cheddar, 1/2 cup mayonnaise, 1 tablespoon Dijon mustard, 1 tablespoon fresh lemon juice, 1 teaspoon garlic powder, and 1 teaspoon Old Bay seasoning. Fold the ingredients gently to keep crab lumps intact. Taste and adjust seasoning — if the crab is very salty, skip adding extra salt. Chill the mixture 15–30 minutes if possible to firm it up, which makes assembly easier and prevents the biscuits from becoming soggy. Preheat oven and prep baking sheet: Preheat the oven to 375°F (190°C). Line a rimmed baking sheet with parchment paper or lightly grease with butter or neutral oil. Position a rack in the middle to encourage even browning. Lay out your biscuit dough on a clean surface ready for filling. Assemble biscuit pockets: Flatten each biscuit to about 1/4-inch thickness using your fingers or a rolling pin. Place about 2 tablespoons of the chilled filling in the center of each round. Fold the dough over to create a pocket and pinch the seams tightly; use a fork to crimp or press with dough scraps to patch any tears. Arrange pockets about 1" apart on the prepared sheet so they have room to rise. Bake until golden: Bake for 12–15 minutes, rotating the sheet halfway through, until the biscuits are puffed and golden brown. Internal filling should be hot and bubbly; if unsure, check one center with an instant-read thermometer — it should read at least 140°F (60°C). For a glossy finish, brush with melted butter as soon as they come out of the oven. Rest and serve: Allow the biscuits to rest 3–5 minutes on the baking sheet before transferring to a serving platter. Sprinkle with chopped fresh parsley and serve warm with lemon wedges or a garlic aioli for dipping. Baked shrimp and crab biscuits on a parchment-lined tray

You Must Know

  • These pockets freeze well for up to 3 months when wrapped individually; thaw overnight in the refrigerator and reheat at 350°F (175°C) until warmed through.
  • High in protein because of shrimp, crab, and cheddar; however, they are not suitable for dairy-free or gluten-free diets unless modified.
  • Do not overwork the biscuit dough — keep it slightly cool for best rise and flaky layers.
  • Make the filling a day ahead to deepen flavor and streamline assembly on the day of serving.

My favorite part is watching guests break one open and discover the warm, creamy center. At a recent potluck, someone asked for the recipe, then returned later to say they’d made a tear in the seam and still loved it — proof that these are forgiving and delicious even when imperfectly sealed.

Close-up of a bisected biscuit showing the cheesy seafood filling

Storage Tips

Store leftovers in an airtight container in the refrigerator for up to 3 days. To reheat, place biscuits on a baking sheet and warm at 350°F (175°C) for 8–10 minutes to regain crispness; avoid microwaving unless necessary, as the biscuit exterior will become soft. For freezing, arrange cooled, unbaked pockets on a tray, freeze until firm, then transfer to a resealable bag; bake from frozen at 375°F (190°C), adding 5–8 minutes to the baking time. Use parchment or silicone-lined containers to prevent sticking and preserve flakiness.

Ingredient Substitutions

If you need to adapt, several swaps work well: substitute Monterey Jack or Gruyère for cheddar for a milder or nuttier melt. Use Greek yogurt mixed with a teaspoon of Dijon instead of some mayonnaise to reduce richness (use a total of 1/3 cup mayo + 2 tbsp Greek yogurt). For a gluten-free version, use a gluten-free biscuit dough or puff pastry; note texture and baking times will differ. If crab is scarce, use more chopped shrimp or a mix of flaky white fish, but keep the seasoning balance since crab adds sweetness.

Serving Suggestions

Serve these with tomato-caper salad, lemony slaw, or a simple mixed-green salad to cut through richness. For a brunch spread, pair with scrambled eggs and roasted cherry tomatoes. Garnish with extra chopped parsley and lemon wedges for brightness. For dipping, a garlic aioli, remoulade, or a thin lemon-butter sauce complements the delicate shellfish flavors beautifully.

Cultural Background

Seafood-stuffed pastries are found in many coastal cuisines; this particular mix of crab, shrimp, and Old Bay seasoning draws from American Atlantic coast traditions where Old Bay is a hallmark seasoning. Tucking seafood into bread or pastry has roots in both practical preservation and portability — easy to eat, carry, and share. These pockets marry the Southern love for biscuits with New England and Mid-Atlantic seafood flavors for a hybrid that feels both familiar and festive.

Seasonal Adaptations

In spring and summer, lighten the filling with fresh herbs like tarragon and chives and add diced cucumber relish on the side. In colder months, fold in a spoonful of crème fraîche and swap lemon for a splash of white wine for depth. For holiday gatherings, make mini versions and add a pinch of smoked paprika or a few drops of hot sauce for warmth; their portable nature makes them perfect for finger-food spreads.

Meal Prep Tips

Mix the filling up to 24 hours ahead and chill in an airtight container — chilled filling is easier to portion and results in neater pockets. Pre-portion filling into tablespoon scoops and place on a tray covered until ready to assemble. If making a large batch, bake in two sheets to avoid crowding and rotate racks for even browning. Label and date frozen pockets so you can pull them for quick weeknight dinners or unexpected guests.

These savory seafood pockets are a comforting, impressive dish that’s surprisingly simple to make. Whether you’re feeding a crowd or treating yourself, they marry convenience with coastal flavor — a recipe I return to again and again. Give them a try, and make them your own with the seasoning and accompaniments you love.

Pro Tips

  • Chill the filling for at least 15 minutes before assembling to reduce sogginess and make portioning easier.

  • Pat seafood dry and drain lump crab gently to avoid adding excess moisture to the filling.

  • Use fresh-grated cheddar rather than pre-shredded for a creamier melt and better texture.

This nourishing delicious shrimp and crab biscuits recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Quick & Easy Mealsseafoodbiscuitsshrimpcrabrecipeweeknightfamily-friendly
No ratings yet

Delicious Shrimp and Crab Biscuits

This Delicious Shrimp and Crab Biscuits recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 8 steaks
Delicious Shrimp and Crab Biscuits
Prep:15 minutes
Cook:15 minutes
Rest Time:10 mins
Total:30 minutes

Instructions

1

Prepare the filling

Combine chopped cooked shrimp, lump crab meat, shredded cheddar, mayonnaise, Dijon mustard, fresh lemon juice, garlic powder, and Old Bay in a mixing bowl. Fold gently to maintain crab lumps and chill 15–30 minutes to firm mixture.

2

Preheat oven and prep baking sheet

Preheat oven to 375°F (190°C). Line a rimmed baking sheet with parchment paper or lightly grease. Position oven rack in the center for even browning.

3

Assemble biscuit pockets

Flatten each biscuit to approximately 1/4-inch thickness, place roughly 2 tablespoons of filling in the center, and fold dough over to form a pocket. Seal seams firmly and patch tears with dough scraps.

4

Bake until golden

Bake assembled pockets 12–15 minutes, rotating halfway, until golden brown and filling is hot. Brush with melted butter after baking for shine if desired.

5

Rest and serve

Let biscuits rest 3–5 minutes before serving. Sprinkle with chopped parsley and serve warm with lemon wedges or aioli.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 390kcal | Carbohydrates: 28g | Protein:
18g | Fat: 24g | Saturated Fat: 7g |
Polyunsaturated Fat: 5g | Monounsaturated Fat:
10g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@easywhiskrecipes on social media!

Delicious Shrimp and Crab Biscuits

Categories:

Delicious Shrimp and Crab Biscuits

Did You Make This?

Leave a comment & rating below or tag @easywhiskrecipes on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Sophie!

Chef and recipe creator specializing in delicious Quick & Easy Meals cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.